PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G089300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 600aa    MW: 64180.6 Da    PI: 8.5782
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G089300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.3e-103804171954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yp+  +++ LAk++gLt +qV++WF N R +
  Brast01G089300.1.p 380 FEHflHPYPTDGDKQMLAKQTGLTRNQVSNWFINARVR 417
                         554459******************************88 PP

2BELL88.38.4e-29248317372
                BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                         +e + kk++L+s++eeV+krY+qy+ q+q+vi+sFe+v g  +a+p++++Al+ +++hF+cLk +i +q+
  Brast01G089300.1.p 248 AEQHWKKTRLISMMEEVCKRYRQYYRQVQAVIASFETVSGFSNAAPFAAMALRVMAKHFKCLKGMILNQL 317
                         57899*************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-33177315IPR006563POX domain
PfamPF075269.3E-36182313IPR006563POX domain
PROSITE profilePS5007112.422358421IPR001356Homeobox domain
SMARTSM003891.7E-10361425IPR001356Homeobox domain
CDDcd000866.21E-13361422No hitNo description
SuperFamilySSF466895.99E-17363428IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-28364425IPR009057Homeodomain-like
PfamPF059206.4E-19378417IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 600 aa     Download sequence    Send to blast
MSSPAGGGYG GGAGSGAEPP HHHGHLLLQH HYAHHVAAAA AAAASGQMYH VPQHSRREKL  60
RFPPDGAAAS DSPPAALASH QHGAGAWPPP AFYSYASSSS SYSPHSPTTL PQQMAPSNGL  120
TAAPQLPQIP PQQNFSLSLS SASSNPPATP RRQPQQLGGG GGPAAQATAT GPYGPFTGYA  180
TVLGRSRFLD PAQKLLEEIC DVGGAHVDRS VPGEDLLEAD PMDGEDAAAV VGHDIDAADR  240
DAGSMSGAEQ HWKKTRLISM MEEVCKRYRQ YYRQVQAVIA SFETVSGFSN AAPFAAMALR  300
VMAKHFKCLK GMILNQLRNT SKIAVKEGMS KDIVVFGLGG GGAGFQRGSS VNGFGQPNNI  360
WRPQRGLPER SVSVLRAWLF EHFLHPYPTD GDKQMLAKQT GLTRNQVSNW FINARVRLWK  420
PMVEEIHNLE MKIHKRSAPD KGQHGIHNLT QHSSQCSGKR SEPCDSQPGQ SSSITRNHNT  480
PASHGFPDEL SQMSQSIQQS QVSLAYNRLS SQHNMASPQH QHVSGVGGAG SSSVSLTLGL  540
HQNNRVCFGE PLQSALPANL AHRFGLEDVN DAYVMNSFAG QDRHFTKEIG GHLLHDFVG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16367424158Homeobox protein Meis1
4xrs_B1e-16367424158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466471e-134AB546647.1 Triticum aestivum WBLH4 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564609.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLI1HTD80.0I1HTD8_BRADI; Uncharacterized protein
STRINGBRADI2G54940.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.16e-70TALE family protein